Print…

You Searched For: (3-Bromo-2,5-difluorophenyl)(methyl)sulfane


4  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"4"

Rate These Search Results

Image Unavailable-103007-178

Trp Cage 1 mg

Description: Trp Cage, Sequence: NLYIQWLKDGGPSSGRPPPS, Purity: HPLC greater than or equal to 95%, peptide is a C-terminal fragment of exendin-4, Trp Cage is a highly stable mini-protein fold, Molecular Weight: 2169.4, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-178
Supplier: Anaspec Inc
Image Unavailable-103008-370

[Arg(Me1)17]-Histone H3 (1-21)-GGK,Biotin

Description: [Arg(Me1)17]-Histone H3 (1-21)-GGK,Biotin
Catalog Number: 103008-370
Supplier: Anaspec Inc
Image Unavailable-103007-964

[Lys(Me3)4]-Histone H3 (1-21)-GGK(Biotin) H3K4(Me3) 1 mg

Description: [Lys(Me3)4]-Histone H3 (1-21)-GGK(Biotin) H3K4(Me3), biotin-labeled, Sequence: ART-K(Me3)-QTARKSTGGKAPRKQLA-GGK(Biotin)-NH2, Purity: By HPLC >/= 95%, corresponding to amino acids 1-21 of human histone H3, Molecular Weight: 2765.2, Size: 1 mg
Catalog Number: 103007-964
Supplier: Anaspec Inc
Image Unavailable-103006-416

Biotin-TAT (47-57) 1 mg

Description: Biotin-TAT (47-57), HIV-derived cell penetrating TAT peptide, Purity: HPLC is greater than or equal to 95%, Sequence (One-Letter Code): Biotin-YGRKKRRQRRR, Molecular Weight: 1786.2, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 1 mg
Catalog Number: 103006-416
Supplier: Anaspec Inc
Image Unavailable-103006-558

MCRAMP mouse 1 mg

Description: MCRAMP, mouse cathelicidin-related antimicrobial peptide (mCRAMP) is the sole murine cathelicidin, Purity: HPLC>/=95%, Sequence (One-Letter Code): GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ, Molecular weight: 3878.7, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 1 mg
Catalog Number: 103006-558
Supplier: Anaspec Inc
Image Unavailable-103003-906

ACTH (1 - 39) 0.5 mg

Description: ACTH (1 - 39), human, Purity: HPLC >/- 95%, Molecular Weight: 4541.1, Sequence: SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF, Adrenocorticotropic hormone (ACTH), also known as corticotropin, is a cleavage product from a larger precursor proopiomelanocortin, Size: 0.5 mg
Catalog Number: 103003-906
Supplier: Anaspec Inc
Image Unavailable-103008-034

[Lys(Me3)27]-Histone H3 (23-34) H3K27(Me3) 1 mg

Description: [Lys(Me3)27]-Histone H3 (23-34), H3K27(Me3), Sequence: KAAR-K(Me3)-SAPATGG, Purity: By HPLC >/= 95%, peptide is Histone H3 amino acid residues 23 to 34 tri-methylated at Lys-27, Molecular Weight: 1156.3, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103008-034
Supplier: Anaspec Inc
Image Unavailable-102996-266

PACAP (1-27) 0.5 mg

Description: PACAP (1-27), amide, human, ovine, rat, Purity: HPLC >/= to 95%, Molecular Weight: 3147.7, Sequence: HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2, is a neuropeptide originally isolated from bovine hypothalamus, It shows considerable homology with VIP, Storage: -20 deg C, Size: 0.5 mg
Catalog Number: 102996-266
Supplier: Anaspec Inc
Image Unavailable-103003-296

ARP 10 mg

Description: ARP [[N-(Aminooxyacetyl)-N''''-(D- biotinoyl) hydrazine, trifluoroacetic acid salt]], Molecular Weight: 445.4, Appearance: solid, Solvent System: DMSO or DMF, Biotinylating reagent for carbohydrates and nucleic acids, Storage: -20 deg C, Size: 10 mg
Catalog Number: 103003-296
Supplier: Anaspec Inc
Image Unavailable-102996-484

Beta-Amyloid (1-28) 0.5 mg

Description: Beta-Amyloid (1-28), Human, Purity: HPLC >/= to 95%, Molecular Weight: 3262.5, Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNK, The three-dimensional solution structure of AB (1-28) reveals the folding of the peptide, Storage: -20 deg C, Size: 0.5 mg
Catalog Number: 102996-484
Supplier: Anaspec Inc
Image Unavailable-103011-294

Collagen (Type IV) 1 mg

Description: Collagen (Type IV), FAM conjugated, heavily labeled with a fluorescein derivative, Concentration: 1 mg/mL, Fluorescence: Excitation/Emission wavelength= 490 nm/520 nm, Spectral Properties: Abs/Em = 492/515 nm, Solvent System: Water insoluble, Storage -20 deg C, Size: 1 mg
Catalog Number: 103011-294
Supplier: Anaspec Inc
Image Unavailable-102996-488

Beta-Amyloid (1-28) 5 mg

Description: Beta-Amyloid (1-28), Human, Purity: HPLC >/= to 95%, Molecular Weight: 3262.5, Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNK, The three-dimensional solution structure of AB (1-28) reveals the folding of the peptide, Storage: -20 deg C, Size: 5 mg
Catalog Number: 102996-488
Supplier: Anaspec Inc
Image Unavailable-102996-110

Gastrin-1 1 mg

Description: Gastrin-1, human, Purity: HPLC >/= 95%, Molecular Weight: 2098.2, Sequence: Pyr-GPWLEEEEEAYGWMDF-NH2, Appearance: Powder, Secretion of gastrin is induced by food intake and causes the release of gastric acid in the stomach, Storage: -20 deg C, Size: 1mg
Catalog Number: 102996-110
Supplier: Anaspec Inc
Image Unavailable-103004-650

MOG (1 - 125) Recombinant protein 100 ug

Description: MOG (1 - 125), Recombinant protein, Source: Rat, Purity: Greater than 95% (SDS-PAGE), Endotoxin (EU/ug): Less than 0.1 EU per 1 ug of the protein as determined by Limulus Amebocyte Lysate (LAL), quantitative kinetic assay, Application: ELISA, Size: 100ug
Catalog Number: 103004-650
Supplier: Anaspec Inc
Image Unavailable-103010-586

SensoLyte* Green SIRT2 Assay Kit

Description: SensoLyte* Green SIRT2 Assay Kit *Fluorimetric*, Components: SIRT2 substrate 1 mM, 100 uL, Deacetylated reference substrate 1 mM, 20 uL, SIRT2 0.25 mg/mL, 40 uL, Assay Buffer 20 mL, NAD+ 50 mM, 100 uL, Nicotinamide 30 mM, 0.5 mL, SIRT2 Developer (10X) 0.5 mL
Catalog Number: 103010-586
Supplier: Anaspec Inc
Image Unavailable-103010-194

HiLyte* Fluor 647 amine 1 mg

Description: HiLyte* Fluor 647 amine, Purity >/=95% HPLC, Molecular Weight: 1045.34, Solvent System: water, is a carbonyl-reactive fluorescent labeling dye that generates the conjugates that are slightly red-shifted compared to those of Cy5 dyes, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103010-194
Supplier: Anaspec Inc
1 - 4 of 4